Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Mitochondrial ROS Detection Assay Kit

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

Beta-Amyloid (1-42), Scrambled, 5-FAM labeled, Human - ANA60892 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-42), Scrambled, 5-FAM labeled, Human
print page
Size: 0.1 mg
£313.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60892
Name:
Beta-Amyloid (1-42), Scrambled, 5-FAM labeled, Human
Supplier:
Availability:

Beta-Amyloid (1-42), Scrambled, 5-FAM labeled, Human - 0.1 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4873.4
UNSPSC Code:
12352202
Contact Our Customer Service Team
Tonbo Biosciences