Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Same Day Delivered Fresh Human Blood
Find Your Peptide Simply with Our Peptide Search

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

 

Chlorotoxin (Cltx) - ANA60770 - 0.1 mg - AnaSpec - proteins & peptides

Chlorotoxin (Cltx)
print page
Size: 0.1 mg
£152.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60770
Name:
Chlorotoxin (Cltx)
Supplier:
Availability:

A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3996
Reference:
Ref: DeBin, JA. and GR. Strichartz, Toxicon 29, 1403 (1991); DeBin, JA. et al. Am. J. Physiol. 264, C361 (1993).
UNSPSC Code:
12352202
Contact Our Customer Service Team