Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Express Lentiviral Packaging Services
Over 40,000 Peptides & Proteins Available

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

hBD-3, β-Defensin-3, human - ANA60741 - 0.1 mg - AnaSpec - proteins & peptides

hBD-3, β-Defensin-3, human
print page
Size: 0.1 mg
£400.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60741
Name:
hBD-3, β-Defensin-3, human
Supplier:
Availability:

This is a 5.1kDa 45-amino acid antimicrobial peptide called beta-Defensin-3 (hBD-3) having a beta sheet with three intramolecular disulfide bonds. It is expressed in high levels in keratinocytes and tonsilar tissue while expressed low in epithelia of the respiratory, gastrointestinal and genito-urinary tracts. Factors that induce its expression include TNF-alpha, IL-1beta and bacteria such as P. aeruginosa and S. aureus. hBD-3 is also potentially induced after exposure to IFN-gamma. In contrast to hBD-1, -2 and -4, hBD-3 demonstrates a salt-insensitive antimicrobial activity towards several pathogenic microorganisms at physiologic salt concentrations. This makes hBD-3 uniquely and particularly relevant in diseases where other hBDs show inactivity. The ability of hBD-3 to elicit its antimicrobial activity more effectively at the concentrations lower that those of hBD-1 and hBD-2 has been attributed to its amphipathic dimer structure and the increased positive surface charge (+9), compared to hBD-1 (+4) and hBD-2 (+6). hBD-3 has been shown to induce cytokine production from human keratinocytes and stimulates monocyte migration.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
5155.2
Reference:
1, Niyonsaba F and Ogawa H. J Derm Sci. 40, 157-168 (2005). 2, Dhople, V. et al. Biochim. Biophys. Acta 1758, 1499 (2006). 3, Cole, A. Protein and Peptide Lett 12, 41 (2005).
UNSPSC Code:
12352202
Contact Our Customer Service Team
Tonbo Biosciences