Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...

Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Frozen Human Plasma

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards


hBD-1, β-Defensin-1, human - ANA60740 - 0.1 mg - AnaSpec - proteins & peptides

hBD-1, β-Defensin-1, human
print page
Size: 0.1 mg
GBP | Euro | USD
Add to basket
Catalogue number:
hBD-1, β-Defensin-1, human

This is a 3.9kDa 36-amino acid peptide called beta-Defensin-1 (hBD-1) having a beta sheet with three intramolecular disulfide bonds. It is constitutively produced by various epithelial tissues including urogenital and respiratory tracts. It's expression is also inducible in keratinocytes of whole human skin by lipopolysaccharides and peptidoglycan. hBD-1 exhibits antimicrobial activity against several pathogenic microorganisms including E.coli, although its activity is dependent on salt sensitivity, because it is inhibited by salt in a concentration-dependent manner. In addition to its antimicrobial activity, hBD-1 chemoattracts CCChemokine receptor (CCR)6-expressing HEK293 cells, implying that this peptide utilizes CCR6 as a receptor.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
Storage Temp:
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
Niyonsaba F and Ogawa H. J Derm Sci. 40, 157-168 (2005).
Contact Our Customer Service Team