Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Efficient Pathogen DNA & RNA Isolation

Receive High Quality Leukaemia & Lymphoma Biospeciemens Within 24 Hours

 

Glucagon (1-29), bovine, human, porcine, FAM-labeled - ANA60273-1 - 1 mg - AnaSpec - proteins & peptides

Glucagon (1-29), bovine, human, porcine, FAM-labeled
print page
Size: 1 mg
£319.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60273-1
Name:
Glucagon (1-29), bovine, human, porcine, FAM-labeled
Supplier:
Availability:

This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3841.1
Reference:
O'Harte. FP. et. al. Mol Cell Endocrinol 381, 26 (2013), doi: 10.1016/j.mce.2013.07.014Drucker DJ. Endocrinology: Adult and Pediatric (7th Ed.) 1, 586 (2016), doi:10.1016/B978-0-323-18907-1.00034-2
UNSPSC Code:
12352202
Contact Our Friendly Technical Team