Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
High Quality Leukaemia & Lymphoma Blood & Bone Marrow Samples
Over 40,000 Peptides & Proteins Available

Upgrading Your Laser Scanner? Consider The Sapphire™

Beta-Amyloid (1-33), Human - ANA60250-1 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-33), Human
print page
Size: 1 mg
£544.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA60250-1
Name:
Beta-Amyloid (1-33), Human
Supplier:
Availability:

Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer Aβ (1-40) peptide producing soluble 1-33 and 34-40 fragments of Aβ (1-40) without any neurotoxic effects.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3674
Reference:
Ref: Carvalho, K. et al. Braz. J. Med. Biol. Res. 30, 1153 (1997); Maddalena, A. et al. Neurodegenerative Dis. 1, 231 (2004).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team
Tonbo Biosciences