Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Fast & Sensitive Prostaglandin E2 EIA
Over 40,000 Peptides & Proteins Available

Beta-Amyloid Peptide (1-40), mouse, rat - ANA25230 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid Peptide (1-40), mouse, rat
print page
Size: 1 mg
£558.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA25230
Name:
Beta-Amyloid Peptide (1-40), mouse, rat
Supplier:
Availability:

Beta-Amyloid Peptide (1-40), mouse, rat - 1 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4233.8
UNSPSC Code:
12352202