Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Powerful RNA Extraction From FFPE Samples
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

 

Scrambled-beta-Amyloid (1-40), Human - ANA24626 - 1 mg - AnaSpec - proteins & peptides

Scrambled-beta-Amyloid (1-40), Human
print page
Size: 1 mg
£442.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24626
Name:
Scrambled-beta-Amyloid (1-40), Human
Supplier:
Availability:

Scrambled-beta-Amyloid (1-40), Human - 1 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4329.9
UNSPSC Code:
12352202
Contact Our Customer Service Team
Tonbo Biosciences