Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Custom Competent Cell Service

Assemble DNA Constructs Simply & Efficiently Using The Gibson Assembly® Method

[Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin-4 - ANA63714 - 50 µg - AnaSpec - proteins & peptides

[Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin-4
print page
Size: 50 µg
£152.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA63714
Name:
[Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin-4
Supplier:
Availability:

This peptide is HiLyte Fluor 647 labeled Extendin-4 (Ex/Em=650 nm/675 nm). A cysteine residue has been added to the peptide C-terminus, and the dye is conjugated to this cysteine via the cysteine thiol moiety. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
5486.3
Reference:
Eng, J. et al. J Biol Chem 267, 7402 (1992)Greig, NH. et al. Diabetolog 42, 45 (1999)Göke R. et al. J Biol Chem 268, 19650 (1993)
UNSPSC Code:
12352202
Contact Our Customer Service Team