Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Same Day Delivered Fresh Human Blood

Peptide YY (3-36), Human - ANA24406 - 1 mg - AnaSpec - proteins & peptides

Peptide YY (3-36), Human
print page
Size: 1 mg
£325.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24406
Name:
Peptide YY (3-36), Human
Supplier:
Availability:

This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Storage Temp:
-20°C
Molecular Weight:
4049.5
Reference:
Grandt, D. et al. Regul. Peptides 40, 161 (1992); Batterham, R. et al. Nature. 418, 650 (2002).
UNSPSC Code:
12352202