Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Ion Channel Screening & Profiling Services

Beta-Amyloid (1-39), Human - ANA24296 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-39), Human
print page
Size: 1 mg
£431.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24296
Name:
Beta-Amyloid (1-39), Human
Supplier:
Availability:

A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Storage Temp:
-20°C
Molecular Weight:
4230.7
Reference:
Ref; Jarrett, JT. et al. Biochem. 32, 4693 (1993); Giacomelli, CE. and W. Norde, Macromol. Biosci. 5, 401 (2005).
UNSPSC Code:
12352202