Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:

Large Batches Of Recombinant Human BMP4

Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Upgrading Your Laser Scanner? Consider The Sapphire™

Corticotropin Releasing Factor, CRF, human, rat - ANA24254 - 1 mg - AnaSpec - proteins & peptides

Corticotropin Releasing Factor, CRF, human, rat
print page
Size: 1 mg
£251.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24254
Name:
Corticotropin Releasing Factor, CRF, human, rat
Supplier:
Availability:

Corticotropin Related Peptides

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4757.5
UNSPSC Code:
12352202
Contact Our Customer Service Team