Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
High Quality DNA & RNA Purification From Agarose
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Gastrin Releasing Peptide, Human - ANA24213 - 0.5 mg - AnaSpec - proteins & peptides

Gastrin Releasing Peptide, Human
print page
Size: 0.5 mg
£150.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24213
Name:
Gastrin Releasing Peptide, Human
Supplier:
Availability:

Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, stimulates the release of Gastrin, and shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Storage Temp:
-20°C
Molecular Weight:
2859.4
Reference:
Kamata, K. et al. Nephrol Dialysis Transplant 11, 1267 (1996), doi: 10.1093/ndt/11. 7.1267Taché, Y. et al. Gastroenterol 81, 298 (1981) Siegfried, J. et al. J Biol Chem 269, 8596 (1994)Patel, O. et al. Biochem Pharmacol 68, 2129 (2004), doi: 10.1016/j.bcp.2004.08.009Niederle, B. Wien Klin Wochenschr 119, 561 (2007), doi: 10.1007/s00508-007-0897-x.
UNSPSC Code:
12352202
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents