Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Fresh Human PBMCs
Find Your Peptide Simply with Our Peptide Search

Anti-BetaGamma (MPS-Phosducin-like protein C terminus) - ANA24177 - 0.5 mg - AnaSpec - proteins & peptides

Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
print page
Size: 0.5 mg
£312.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24177
Name:
Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
Supplier:
Availability:

This is a membrane-permeable phosphoducin-like anti-βγ peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminal residues of phosducin-like protein (PhLP). This region of PhLP has been shown to confer interactions with GβUpsilon -mediated signaling. Specifically, it was shown to have inhibitory effects on Go GTPase activity, demonstrating the ability to bind Gβγ, and inhibition of Gβγ-enhanced rhodopsin phosphorylation by βARK. The PhLP shares amino acid sequence homology with phosphoducin, a phosphoprotein expressed in the retina and pineal gland. These proteins have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
Storage Temp:
-20°C
Molecular Weight:
4601.4
Reference:
1, Orr, A. et al. J. Biol. Chem. 277, 20453 (2002) 2, Chang M. et al. J Biol Chem. 275:7021-7029 (2000).
UNSPSC Code:
12352202