Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available

Efficient Pathogen DNA & RNA Isolation

Find Your Peptide Simply with Our Peptide Search

Optimise Your Microbiomics Workflows with ZymoBIOMICS™ Microbial Community Standards

 

Cecropin B - ANA24011 - 0.5 mg - AnaSpec - proteins & peptides

Cecropin B
print page
Size: 0.5 mg
£232.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24011
Name:
Cecropin B
Supplier:
Availability:

Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
3834.7
Reference:
Ref: Vaara, M. et al. Antimicrob. Agents Chemo. 38, 2498 (1994); Florack, D. et al. Transgenic Res. 4, 132 (1995); Lee, P. et al. Wound Repair Regen. 12, 351 (2004).
UNSPSC Code:
12352202
Contact Our Friendly Technical Team