Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Vector Shuttling & Clone Modification Service
Find Your Peptide Simply with Our Peptide Search

Upgrading Your Laser Scanner? Consider The Sapphire™

Beta-Amyloid (1-40) • HCl, Human - ANA23211 - 0.5 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40) • HCl, Human
print page
Size: 0.5 mg
£239.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23211
Name:
Beta-Amyloid (1-40) • HCl, Human
Supplier:
Availability:

All the HCl salt forms of Aβ (1-40), Aβ (25-35) and D-Ser26 Aβ (25-35), take the β-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HCl
Storage Temp:
-20°C
Compound Purity:
Peak Area by HPLC ≥95%
Molecular Weight:
4329.936
Reference:
Kaneko, I. et al. Nippon Yakurigaku Zasshi. 115, 67 (2000).
UNSPSC Code:
12352202