Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Express Cysteinyl Leukotriene EIA Kit

Corticotropin Releasing Factor, CRF, ovine - ANA22932 - 0.5 mg - AnaSpec - proteins & peptides

Corticotropin Releasing Factor, CRF, ovine
print page
Size: 0.5 mg
£205.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA22932
Name:
Corticotropin Releasing Factor, CRF, ovine
Supplier:
Availability:

Corticotropin Releasing Factor; CRF; ovine

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Storage Temp:
-20°C
Molecular Weight:
4670.4
Reference:
Vale, W. et al. Science 213, 1394 (1981).
UNSPSC Code:
12352202