Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Culture, Quantify, Isolate & Amplify Exosomes
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

Beta-Amyloid (42-1), Human - ANA27276-01 - 0.1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (42-1), Human
print page
Size: 0.1 mg
£143.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA27276-01
Name:
Beta-Amyloid (42-1), Human
Supplier:
Availability:

Anaspec

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Storage Temp:
-20°C
Molecular Weight:
4514.1
UNSPSC Code:
12352202