Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
2D Gap Closure Cell Migration Assay
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

Scrambled-beta-Amyloid (1-40), Human - ANA24625 - 0.5 mg - AnaSpec - proteins & peptides

Scrambled-beta-Amyloid (1-40), Human
print page
Size: 0.5 mg
£233.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24625
Name:
Scrambled-beta-Amyloid (1-40), Human
Supplier:
Availability:

Scramble-beta-Amyloid (1-40)

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Storage Temp:
-20°C
Molecular Weight:
4329.9
UNSPSC Code:
12352202