Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
2D Gap Closure Cell Migration Assay
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

β-Endorphin, Human - ANA24319 - 1 mg - AnaSpec - proteins & peptides

β-Endorphin, Human
print page
Size: 1 mg
£129.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24319
Name:
β-Endorphin, Human
Supplier:
Availability:

b-Endorphin; human

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Storage Temp:
-20°C
Molecular Weight:
3465.1
UNSPSC Code:
12352202