Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
Express Cysteinyl Leukotriene EIA Kit

Beta-Amyloid (1-40), Human - ANA24236 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (1-40), Human
print page
Size: 1 mg
£282.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA24236
Name:
Beta-Amyloid (1-40), Human
Supplier:
Availability:

Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. Electron microscopy of b-amyloid (1-40) stained with Thioflavin T (data generated by an AnaSpec scientist).

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Temp:
-20°C
Molecular Weight:
4329.9
Reference:
Masters, CL. et al. Proc. Natl. Acad. Sci. USA 82, 4245 (1985); Yankner, BA. Neuron 16, 921 (1996); Geula, C. et al. Nat. Med. 4, 827 (1998); Shin, R. et al. J. Neurosci.17, 8187 (1997).
UNSPSC Code:
12352202