Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Over 100,000 Antibodies Performance Guaranteed

PaRathyroid Hormone (1-34)-Lys(Biotin), Human - ANA23647 - 1 mg - AnaSpec - proteins & peptides

PaRathyroid Hormone (1-34)-Lys(Biotin), Human
print page
Size: 1 mg
£776.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23647
Name:
PaRathyroid Hormone (1-34)-Lys(Biotin), Human
Supplier:
Availability:

Parathyroid Hormone (1-34)-Lys(Biotin); human

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
Storage Temp:
-20°C
Molecular Weight:
4472.2
UNSPSC Code:
12352202