Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Accurate & Targeted Monoclonal Antibodies
Over 40,000 Peptides & Proteins Available

Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, Human - ANA23642 - 0.5 mg - AnaSpec - proteins & peptides

Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, Human
print page
Size: 0.5 mg
£355.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23642
Name:
Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, Human
Supplier:
Availability:

Glucagon-Like Peptide 1 (7-36)-Lys(Biotin); amide; human

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
Storage Temp:
-20°C
Molecular Weight:
3551.8
Reference:
Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999) Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197
UNSPSC Code:
12352202