Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Exceptional Cloning With Transcription & Translation-Free Vectors
Over 40,000 Peptides & Proteins Available

Cys-beta-Amyloid (1-42), Human - ANA23538 - 1 mg - AnaSpec - proteins & peptides

Cys-beta-Amyloid (1-42), Human
print page
Size: 1 mg
£1238.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA23538
Name:
Cys-beta-Amyloid (1-42), Human
Supplier:
Availability:

Cys-beta-Amyloid (1-42), Human - 1 mg

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Storage Temp:
-20°C
Molecular Weight:
4617.3
UNSPSC Code:
12352202