Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
3D Collagen Matrix Cell Contraction Assay
Find Your Peptide Simply with Our Peptide Search

Pancreatic Polypeptide, Human - ANA22866 - 0.5 mg - AnaSpec - proteins & peptides

Pancreatic Polypeptide, Human
print page
Size: 0.5 mg
£157.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA22866
Name:
Pancreatic Polypeptide, Human
Supplier:
Availability:

Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplisehd through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin and Obestatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
Storage Temp:
-20°C
Molecular Weight:
4181.8
Reference:
Williams, JA. Pancreapedia (2014), doi: 10.3998/panc.2014.4Khandekar, N. et al. Mol Cell Endocrinol (2015), doi: 10.1016/j.mce.2015.06.028
UNSPSC Code:
12352202