Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Fresh Human PBMCs
Over 40,000 Peptides & Proteins Available

Beta-Amyloid (40-1), Human - ANA22818 - 1 mg - AnaSpec - proteins & peptides

Beta-Amyloid (40-1), Human
print page
Size: 1 mg
£418.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA22818
Name:
Beta-Amyloid (40-1), Human
Supplier:
Availability:

Beta-Amyloid (40-1)

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Storage Temp:
-20°C
Molecular Weight:
4329.9
UNSPSC Code:
12352202