Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
3D Collagen Matrix Cell Contraction Assay
Find Your Peptide Simply with Our Peptide Search

PACAP (6-38), amide, Human, ovine, Rat - ANA22517 - 1 mg - AnaSpec - proteins & peptides

PACAP (6-38), amide, Human, ovine, Rat
print page
Size: 1 mg
£390.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA22517
Name:
PACAP (6-38), amide, Human, ovine, Rat
Supplier:
Availability:

This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Storage Temp:
-20°C
Molecular Weight:
4024.8
Reference:
Robberecht, P. et al. Eur. J. Biochem. 207, 239 (1992).
UNSPSC Code:
12352202