Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search
2D Gap Closure Cell Migration Assay

Glucagon-Like Peptide 1, GLP-1 (7-36), amide, Human - ANA22463 - 1 mg - AnaSpec - proteins & peptides

Glucagon-Like Peptide 1, GLP-1 (7-36), amide, Human
print page
Size: 1 mg
£298.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA22463
Name:
Glucagon-Like Peptide 1, GLP-1 (7-36), amide, Human
Supplier:
Availability:

GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Storage Temp:
-20°C
Molecular Weight:
3297.7
Reference:
Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999)Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197
UNSPSC Code:
12352202