Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available
Same Day Delivered Fresh Human Blood

Glucagon (1-37), Oxyntomodulin, porcine - ANA22455 - 1 mg - AnaSpec - proteins & peptides

Glucagon (1-37), Oxyntomodulin, porcine
print page
Size: 1 mg
£850.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA22455
Name:
Glucagon (1-37), Oxyntomodulin, porcine
Supplier:
Availability:

Following nutrient ingestion, both GLP-1, and Oxyntomodulin (OXM) are processed from proglucagon and secreted from the gut endocine L-cells. Oxyntomodulin (OXM) a 37-amino acid peptide hormone causes weight loss in humans and rodents. It activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). It contains the same sequence as Glucagon (1-29), but with an additional KRNKNNIA C-terminal sequence.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Storage Temp:
-20°C
Molecular Weight:
4421.9
Reference:
Pocai A. Mol Metab 3, 241 (2014), doi:10.1016/j.molmet.2013.12.001
UNSPSC Code:
12352202