Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Rapid & Sensitive 8-OHdG Quantification
Over 40,000 Peptides & Proteins Available

TIP 39, Tuberoinfundibular Neuropeptide - ANA21687 - 1 mg - AnaSpec - proteins & peptides

TIP 39, Tuberoinfundibular Neuropeptide
print page
Size: 1 mg
£543.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA21687
Name:
TIP 39, Tuberoinfundibular Neuropeptide
Supplier:
Availability:

This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Storage Temp:
-20°C
Compound Purity:
% Peak Area By HPLC ≥95%
Molecular Weight:
4504.3
Reference:
Usdin, TB. et al. Nat. Am. 2, 941 (1999); Piserchio, A. et al. J. Biol. Chem. 275, 27284 (2000).
UNSPSC Code:
12352202