Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

PaRathyroid Hormone (1-34), Human - ANA20708 - 1 mg - AnaSpec - proteins & peptides

PaRathyroid Hormone (1-34), Human
print page
Size: 1 mg
£221.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA20708
Name:
PaRathyroid Hormone (1-34), Human
Supplier:
Availability:

Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Storage Temp:
-20°C
Compound Purity:
% Peak Area By HPLC ≥95%
Molecular Weight:
4117.8
Reference:
Shao, J. et al. J. Biol. Chem. 278, 50195 (2003); Shew, RL. and PKT. Pang Peptides 5, 485 (1984).
UNSPSC Code:
12352202
Lipocalyx - Novel Active Endosome Escape Based Transfection Reagents