Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Lentiviral Packaging, Concentration & Titering Kit
Find Your Peptide Simply with Our Peptide Search
Over 40,000 Peptides & Proteins Available

ACTH (7-38), Human - ANA20618 - 1 mg - AnaSpec - proteins & peptides

ACTH (7-38), Human
print page
Size: 1 mg
£157.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA20618
Name:
ACTH (7-38), Human
Supplier:
Availability:

Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Storage Temp:
-20°C
Compound Purity:
% Peak Area By HPLC ≥95%
Molecular Weight:
3659.2
Reference:
Malendowicz, L. et al. J. Steroid Biochem. Mol. Biol. 67, 149 (1998); Li, CH. et al. Proc. Natl. Acad. Sci. USA 75, 4306 (1978)
UNSPSC Code:
12352202