Tel: +44 (0)1223 316 855
life science research products, biological research products, biotechnology
close ...


Supplier:
Product types:
Streamlined & Simplified DNA Bisulphite Conversion Kits
Over 40,000 Peptides & Proteins Available
Find Your Peptide Simply with Our Peptide Search

ACTH (1-39), Human - ANA20610 - 0.5 mg - AnaSpec - proteins & peptides

ACTH (1-39), Human
print page
Size: 0.5 mg
£164.00
GBP | Euro | USD
Add to basket
Catalogue number:
ANA20610
Name:
ACTH (1-39), Human
Supplier:
Availability:

Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a cleavage product from a larger precursor proopiomelanocortin (POMC). This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R). In mammals, the action of ACTH is limited to those areas of the adrenal cortex in which the glucocorticoid hormones cortisol (hydrocortisone) and corticosterone are formed. ACTH has little control over the secretion of aldosterone, the other major steroid hormone from the adrenal cortex.

Data sheet:

Click to view / download

Product Type:
Proteins & Peptides
Alternative Names:
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Storage Temp:
-20°C
Compound Purity:
% Peak Area By HPLC ≥95%
Molecular Weight:
4541.1
Reference:
Stewart, PM. et al. Clin Endocrinol 40, 199 (1994)Elias, LL. and AJ. Clark, Braz J Med Biol Res 33, 1245 (2000)Latronico, AC. Braz J Med Biol Res 33, 1249 (2000)
UNSPSC Code:
12352202